Relation Results

Summary

Name CSK
Full Name Tyrosine-protein kinase CSK
Synonyms C-Src kinase, Protein-tyrosine kinase CYL
Primary ID P41240
Links - -
Type protein
Relations 13
Pathways EBV infection, Mitochondrial dynamics in T cell exhaustion, T cell activation
Inhibitors lapatinib
Function Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Ph ...
View More

Viewer

Type: Score: Layout: SPV 
0.3380.4710.20.5350.5340.5340.5660.5470.3470.80.5310.20.282PRKACACSKPTPRCLCKLYNFGRSRCPECAM1IGF1RlapatinibCREBBPITCHNOTCH1

Modifications Tables

Relations

Regulator
Mechanism
target
score
+ up-regulates activity img/direct-activation.png phosphorylation CSK 0.338
Identifier Residue Sequence Organism Cell Line
SIGNOR-105229 Ser364 ALREKKFsTKSDVWS Homo sapiens T-lymphocyte
pmid sentence
Activation of the cooh-terminal src kinase (csk) by camp-dependent protein kinase inhibits signaling through the t cell receptor.Pka phosphorylates csk at s364 in vitro and in vivo leading to a two- to fourfold increase in csk activity that is necessary for camp-mediated inhibition of tcr-induced interleukin 2 secretion.
Publications: 1 Organism: Homo Sapiens
+ up-regulates img/direct-activation.png phosphorylation PTPRC 0.471
Identifier Residue Sequence Organism Cell Line
SIGNOR-26785 Tyr1218 MVSTFEQyQFLYDVI Homo sapiens T-lymphocyte
pmid sentence
Tyrosine phosphorylation of cd45 phosphotyrosine phosphatase by p50csk kinase creates a binding site for p56lck tyrosine kinase and activates the phosphatase.
Publications: 1 Organism: Homo Sapiens
Pathways:T cell activation
+ up-regulates activity img/direct-activation.png phosphorylation CSK 0.2
Identifier Residue Sequence Organism Cell Line
SIGNOR-250778 Tyr304 DVCEAMEyLEGNNFV in vitro
pmid sentence
Taken together these results indicate that Csk can be phosphorylated in vivo at Tyr-184 by an as yet unknown tyrosine kinase, and that autophosphorylation of Tyr-304 occurs only at abnormally high Csk concentrations in vitro. Furthermore, Tyr-304 is required for the maintenance of the structure of the Csk kinase domain.
Publications: 1 Organism: In Vitro
Pathways:EBV infection, T cell activation
+ down-regulates img/direct_inhibition.png phosphorylation LCK 0.535
Identifier Residue Sequence Organism Cell Line
SIGNOR-20371 Tyr505 FTATEGQyQPQP Homo sapiens T-lymphocyte
pmid sentence
P50csk tyrosine kinase phosphorylates p56lck at tyr-505 and down regulates its catalytic activity.
Publications: 1 Organism: Homo Sapiens
Pathways:T cell activation
+ down-regulates img/direct_inhibition.png phosphorylation LYN 0.534
Identifier Residue Sequence Organism Cell Line
SIGNOR-132912 Tyr508 YTATEGQyQQQP Homo sapiens B-lymphocyte
pmid sentence
Lyn tyr507 kinase, csk, is recruited by pag, which targets lipid rafts by palmitoylation.Thus, our data suggest that il-6 treatment induces the translocation of cd45 to lipid rafts sequentially, followed by the association of cd45 with lyn and pag;dephosphorylation of lyn tyr507 and pag tyr314;lyn activation;and csk release from lipid rafts
Publications: 1 Organism: Homo Sapiens
Pathways:EBV infection
+ down-regulates activity img/direct_inhibition.png phosphorylation FGR 0.534
Identifier Residue Sequence Organism Cell Line
SIGNOR-250779 Tyr523 FTSAEPQyQPGDQT in vitro
pmid sentence
CSK catalyzed phosphorylation affects Tyr-511 of c-Fgr, homologous to Tyr-527 of c-Src and it prevents the autophosphorylation normally occurring at c-Fgr Tyr-400, homologous to c-Src Tyr-416. | Once phosphorylated at Tyr-511 and down-regulated by CSK, c-Fgr is no more susceptible to polylysine stimulation.
Publications: 1 Organism: In Vitro
+ down-regulates img/direct_inhibition.png phosphorylation SRC 0.566
Identifier Residue Sequence Organism Cell Line
SIGNOR-179417 Tyr530 FTSTEPQyQPGENL Homo sapiens
pmid sentence
The catalytic activity of the src family of tyrosine kinases is suppressed by phosphorylation on a tyrosine residue located near the c terminus (tyr 527 in c-src), which is catalyzed by c-terminal src kinase (csk).
Publications: 1 Organism: Homo Sapiens
+ up-regulates activity img/direct-activation.png phosphorylation PECAM1 0.547
Identifier Residue Sequence Organism Cell Line
SIGNOR-262741 Tyr713 KKDTETVySEVRKAV Chlorocebus aethiops COS-1 Cell
pmid sentence
We demonstrated that phosphorylation of PECAM-1 by Src or Csk family kinases was sufficient to trigger its association with SHP-2. Moreover, it was able to promote binding of PECAM-1 to SHP-1, a SHP-2-related protein-tyrosine phosphatase expressed in hemopoietic cells. Taken together, these findings indicated that the Src and Csk families of kinases are strong candidates for mediating tyrosine phosphorylation of PECAM-1 and triggering its association with SH2 domain-containing phosphatases under physiological circumstances.
Publications: 1 Organism: Chlorocebus Aethiops
+ up-regulates img/indirect-activation.png CSK 0.347
Identifier Residue Sequence Organism Cell Line
SIGNOR-64676 Homo sapiens
pmid sentence
The results suggest that c-src and csk are involved in igf-ir and ir signaling and that the interaction of csk with the igf-ir may play a role in the decrease in c-src activity following igf-i stimulation
Publications: 1 Organism: Homo Sapiens
Pathways:EBV infection
+ down-regulates activity img/direct_inhibition.png chemical inhibition CSK 0.8
Identifier Residue Sequence Organism Cell Line
SIGNOR-257900 Homo sapiens HUVEC Cell
pmid sentence
YN968D1 potently suppressed the kinase activities of VEGFR-2, c-kit and c-src, and inhibited cellular phosphorylation of VEGFR-2, c-kit and PDGFRβ.
Publications: 1 Organism: Homo Sapiens
+ up-regulates img/direct-activation.png binding CSK 0.531
Identifier Residue Sequence Organism Cell Line
SIGNOR-77139 Homo sapiens
pmid sentence
Here we present cbp--a transmembrane phosphoprotein that is ubiquitously expressed and binds specifically to the sh2 domain of csk. Cbp is involved in the membrane localization of csk and in the csk-mediated inhibition of c-src.
Publications: 1 Organism: Homo Sapiens
+ down-regulates activity img/direct_inhibition.png phosphorylation ITCH 0.2
Identifier Residue Sequence Organism Cell Line
SIGNOR-245327 Homo sapiens HEK-293 Cell
pmid sentence
CISK strongly interacts and colocalizes with the E3 ubiquitin ligase AIP4, which is important for the ubiquitin-dependent lysosomal degradation of CXCR4. Moreover, the observed inhibition is both dependent on the interaction between CISK and AIP4 and on the activation status of CISK. Consistent with this, an activated form of CISK but not of the related kinase SGK1 phosphorylates specific sites of AIP4 in vitro.
Publications: 1 Organism: Homo Sapiens
+ up-regulates img/direct-activation.png binding NOTCH1 0.282
Identifier Residue Sequence Organism Cell Line
SIGNOR-196824 Homo sapiens
pmid sentence
We found that the notch-1-furin interaction is regulated by the non-receptor tyrosine kinase, c-src. c-src and notch-1 are physically associated, and this association is responsible for notch-1 processing and activation
Publications: 1 Organism: Homo Sapiens
a simple tooltip